DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Crispld2

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_612527.2 Gene:Crispld2 / 171547 RGDID:620860 Length:497 Species:Rattus norvegicus


Alignment Length:156 Identity:37/156 - (23%)
Similarity:62/156 - (39%) Gaps:32/156 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KEVFNTTNKYRAMHGCPA-----VTINAALNKLAQEWANHLRDQNTMAHRPNP---KYGENIFLS 89
            :|:....||.|.....||     :|.:..|.:.|..||...    ...|.|..   ..|:|:.:.
  Rat    57 QEILMLHNKLRGQVYPPASNMEYMTWDEELERSAAAWAQRC----LWEHGPASLLVSIGQNLAVH 117

  Fly    90 GGMDVTGDLPVEMWYREINSYDFNKAQ----FVP------TAGHFTQLIWKSSVEMGSGV-ARKA 143
            .|...:....|:.||.|:..|.:....    :.|      ...|:||::|.::.::|..| ..::
  Rat   118 WGRYRSPGFHVQSWYDEVKDYTYPYPHECNPWCPERCSGAMCTHYTQMVWATTNKIGCAVHTCRS 182

  Fly   144 DRTW---------VVCNYNPPGNVVG 160
            ...|         :||||:|.||.:|
  Rat   183 MSVWGDIWENAVYLVCNYSPKGNWIG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 35/152 (23%)
Crispld2NP_612527.2 SCP_euk 56..201 CDD:240180 32/147 (22%)
LCCL 286..370 CDD:128866
LCCL 389..487 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.