DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and CRISP1

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:160 Identity:37/160 - (23%)
Similarity:63/160 - (39%) Gaps:32/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANH-------------LRDQNTMAHR-PNPKYG 83
            :|:.|..|..|..      .:..|.|.|...|:..             :.:.|.:..| ||...|
Human    42 EEIVNIHNALRRR------VVPPASNMLKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCG 100

  Fly    84 ENIFLSGGMDVTGDLPVEMWYREINSY---DFNKAQFVPTAGHFTQLIWKSSVEMGSGVA----R 141
            ||:.:: ...|:....:.:||.|..|:   ::.......|..|:||::|.:|..:|..:|    :
Human   101 ENMHMT-SYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQ 164

  Fly   142 KADRTWVVCNY----NPPGNVVGLFKDNVP 167
            .:.|...||:|    |.|......:|..||
Human   165 GSPRYLYVCHYCHEGNDPETKNEPYKTGVP 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 34/149 (23%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 32/141 (23%)
Crisp 195..249 CDD:285731 37/160 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.