DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Crisp3

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_033769.1 Gene:Crisp3 / 11572 MGIID:102552 Length:241 Species:Mus musculus


Alignment Length:163 Identity:48/163 - (29%)
Similarity:68/163 - (41%) Gaps:28/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QDTKGNNELFLKEVFNTTNK-------------YRAMHGCPAVTINAALNKLAQEWANHLRDQNT 73
            ||....|.|   |..:|:.|             .|.:....:..:|...|..||..|....|:.|
Mouse    20 QDNSQENSL---EKLSTSKKSVQEEIVSKHNQLRRKVSPSGSDLLNMEWNYDAQVNAQQRADKCT 81

  Fly    74 MAHRP------NPKYGENIFLSGGMDVTGDLPVEMWYREINSYDF--NKAQFVPTAGHFTQLIWK 130
            .:|.|      |.|.|||:|:|..: |.....::.||.|.....|  ...|.|...||.||::||
Mouse    82 FSHSPIELRTTNLKCGENLFMSSYL-VPWSSVIQGWYNESKGLIFGVGPKQNVSVVGHHTQVVWK 145

  Fly   131 SSVEMGSGVARKAD---RTWVVCNYNPPGNVVG 160
            |::::..|||...:   |.:.||.|.|..|..|
Mouse   146 SNLQVACGVAECPENPLRYFYVCRYCPVLNYSG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 42/150 (28%)
Crisp3NP_033769.1 SCP 37..172 CDD:294090 38/135 (28%)
Crisp 194..241 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.