DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and LOC101883528

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_005162473.1 Gene:LOC101883528 / 101883528 -ID:- Length:261 Species:Danio rerio


Alignment Length:108 Identity:29/108 - (26%)
Similarity:47/108 - (43%) Gaps:34/108 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HRPNPKY---GENIFLSGG--------MDVTGDLPVEMWYREINSYDFNKAQFV--PTAGHFTQL 127
            |.|:.::   |||:|:..|        ||         |:.|...|::|.....  ...||:|||
Zfish    73 HNPDLEHLTMGENLFVGTGPFNATKAVMD---------WFNENLDYNYNTNDCAEDKMCGHYTQL 128

  Fly   128 IWKSSVEMGSGV----------ARKADRTWVVCNYNPPGNVVG 160
            :|.::.::|...          ..||  |.::|:|.|.||:.|
Zfish   129 VWANTTKIGCASYFCDTLEKLHFEKA--TLLICDYYPQGNIEG 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 27/104 (26%)
LOC101883528XP_005162473.1 SCP_HrTT-1 28..162 CDD:240186 24/99 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.