DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and crispld2

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_003199065.1 Gene:crispld2 / 100535149 ZFINID:ZDB-GENE-130131-1 Length:508 Species:Danio rerio


Alignment Length:127 Identity:32/127 - (25%)
Similarity:51/127 - (40%) Gaps:27/127 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LNKLAQEWANHLRDQNTMAHRPNP---KYGENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFV 118
            |.:.|..||    :|....|.|..   ..|:|:.:..|...:....|:.||.|:..|.:......
Zfish    91 LERSATSWA----EQCQWEHGPQDLLMSIGQNLAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHEC 151

  Fly   119 ----------PTAGHFTQLIWKSSVEMGSGV---ARK-------ADRTWVVCNYNPPGNVVG 160
                      |...|:|||:|.::..:|..|   .|.       .:..::||||:|.||.:|
Zfish   152 NPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPRMNVWGEIWENAVYLVCNYSPKGNWIG 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 30/123 (24%)
crispld2XP_003199065.1 SCP_euk 61..206 CDD:240180 27/118 (23%)
LCCL 299..382 CDD:128866
LCCL 402..495 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.