DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and LOC100497187

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_017945658.1 Gene:LOC100497187 / 100497187 -ID:- Length:208 Species:Xenopus tropicalis


Alignment Length:154 Identity:67/154 - (43%)
Similarity:88/154 - (57%) Gaps:10/154 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PGPRGQDTKGNNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPK 81
            |..||.|    ..||..:.....||||..|..|.:.:||.|:|.||.|||||...|.|.|  :..
 Frog    57 PSRRGAD----ENLFQTQFLEAHNKYRKKHNVPPMRLNAELSKSAQTWANHLLSINKMQH--SGA 115

  Fly    82 YGENIFL---SGGMDVTGDLPVEMWYREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVARKA 143
            .|||::.   |.|..:.|::.|:.||.|:..||:||..|....|||||::||.|.|:|.|||...
 Frog   116 GGENLYYSYSSRGRTLAGNVAVDAWYNEVKDYDYNKPGFKAATGHFTQVVWKDSKELGVGVATDG 180

  Fly   144 DRT-WVVCNYNPPGNVVGLFKDNV 166
            ..| :||..|:|||||:|.|::||
 Frog   181 KGTFYVVGRYSPPGNVIGQFQENV 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 56/130 (43%)
LOC100497187XP_017945658.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 137 1.000 Inparanoid score I4427
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - mtm9372
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.