DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and crisp2-like

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001188271.2 Gene:crisp2-like / 100495843 -ID:- Length:207 Species:Xenopus tropicalis


Alignment Length:160 Identity:41/160 - (25%)
Similarity:61/160 - (38%) Gaps:29/160 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DTKGNN------ELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRP-NP 80
            ||:..|      .|..:.|..|......|...|...:||. |..|:....|..........| |.
 Frog    31 DTETQNYLVDLHNLLRRSVDPTAKDMLKMEWSPGAALNAQ-NAAAKCVMQHSSATERQIQDPFNY 94

  Fly    81 KYGENIFLSGGMDVTGDLP-----VEMWYREINSYDF----NKAQFVPTAGHFTQLIWKSSVEMG 136
            ..||||:      ||...|     |..|:.|.|.:.:    |..:.:   ||:||:.|..:..:|
 Frog    95 VCGENIY------VTTAKPDWAAAVNSWFNERNDFTYGVGPNSDKMI---GHYTQVAWAKTYLLG 150

  Fly   137 SGVARKADRTW---VVCNYNPPGNVVGLFK 163
            .|:|......:   .:|:|.|.||::...|
 Frog   151 CGLAFCPGNYYPYVSICHYCPMGNMINSIK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 35/139 (25%)
crisp2-likeNP_001188271.2 SCP 33..171 CDD:320774 35/147 (24%)
Crisp 189..>205 CDD:312162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.