DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and crisp1.11

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_031758901.1 Gene:crisp1.11 / 100492430 XenbaseID:XB-GENE-22169829 Length:266 Species:Xenopus tropicalis


Alignment Length:162 Identity:44/162 - (27%)
Similarity:73/162 - (45%) Gaps:28/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEW----ANHLRDQN---TMAHRPNPK--- 81
            :|....:.:.:|.|.|| .:..|     :|.|.|...|    ||:....:   |.:|.|..|   
 Frog    55 DNSTVRQIIIDTHNAYR-RNASP-----SARNMLKMVWNEDAANNAASWSAGCTGSHSPPDKRTI 113

  Fly    82 ----YGENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFVP--TAGHFTQLIWKSSVEMGSGVA 140
                .|||:||: ....:.:..|:.|:.|..|:::......|  ..||:||::|.:|..:|..|:
 Frog   114 PGFSCGENLFLA-SYPASWEEAVKAWFDENESFEYGVGPKSPDQVVGHYTQVMWYNSYMVGCSVS 177

  Fly   141 ---RKADRTWVVCNYNPPGNVVGLFKDNVPPK 169
               :...:.:.||.|.|.||:.|:.  |.|.|
 Frog   178 YCPKSQYKYFYVCQYCPAGNIEGVM--NTPYK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 38/145 (26%)
crisp1.11XP_031758901.1 CAP_CRISP 58..195 CDD:349402 36/143 (25%)
Crisp 212..263 CDD:400739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.