DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and crispld1

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_002937123.2 Gene:crispld1 / 100490431 XenbaseID:XB-GENE-989389 Length:514 Species:Xenopus tropicalis


Alignment Length:168 Identity:43/168 - (25%)
Similarity:65/168 - (38%) Gaps:38/168 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RGQDTKGNNELFLKEVFNTTNKYRAMHGCPAVTI-----NAALNKLAQEWANHLRDQNTMAHRPN 79
            ||:  :...|..:|.:.:..||.|.....||..:     :..|.:.|:.||    :.....|.|.
 Frog    52 RGK--RAITESDMKLILDLHNKLRGEVYPPASNMEFMIWDVELERSAEAWA----ETCLWEHGPA 110

  Fly    80 ---PKYGENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFV----------PTAGHFTQLIWKS 131
               |..|:|:....|........|:.||.|:..|.|...|..          |...|:|||:|.:
 Frog   111 DLLPVIGQNLGAHWGRYRPPTYHVQAWYDEVRDYTFPYPQECDPYCPFRCSGPVCTHYTQLVWAT 175

  Fly   132 SVEMGSGVA------------RKADRTWVVCNYNPPGN 157
            |..:|..:.            .||  .::||||:|.||
 Frog   176 SSRIGCAINLCHNMNVWGQIWPKA--IYLVCNYSPKGN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 40/157 (25%)
crispld1XP_002937123.2 CAP_CRISPLD1 62..207 CDD:349407 36/150 (24%)
LCCL 304..388 CDD:128866
LCCL 407..506 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.