DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and crispld1a

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_001920421.2 Gene:crispld1a / 100149104 ZFINID:ZDB-GENE-090612-1 Length:508 Species:Danio rerio


Alignment Length:154 Identity:39/154 - (25%)
Similarity:62/154 - (40%) Gaps:32/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LKEVFNTTNKYRAMHGCPAVTI-----NAALNKLAQEWANHLRDQNTMAHRPN---PKYGENIFL 88
            ::.:.:..||.|.....||..:     :..|.:.|:|||    :.....|.|.   |:.|:|:.:
Zfish    67 MQAILDLHNKLRGQVYPPASNMEYMVWDNELERSAEEWA----ETCLWEHGPAGLLPQIGQNLGV 127

  Fly    89 SGGMDVTGDLPVEMWYREINSYDFNKAQFV----------PTAGHFTQLIWKSSVEMGSGV---- 139
            ..|........|:.||.|:..|.|...|..          |...|:|||:|.:|..:|..:    
Zfish   128 HWGRYRPPTSHVQAWYDEVKDYSFPYPQECNPHCPFRCSGPVCTHYTQLVWATSSRIGCAINVCY 192

  Fly   140 ------ARKADRTWVVCNYNPPGN 157
                  ...|...::||||:|.||
Zfish   193 NMNVWGQIWAKAVYLVCNYSPKGN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 39/154 (25%)
crispld1aXP_001920421.2 SCP_euk 68..212 CDD:240180 35/147 (24%)
LCCL 298..381 CDD:128866
LCCL 401..500 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.