DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and XB5812873

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_031758624.1 Gene:XB5812873 / 100127722 XenbaseID:XB-GENE-5812874 Length:272 Species:Xenopus tropicalis


Alignment Length:149 Identity:38/149 - (25%)
Similarity:61/149 - (40%) Gaps:20/149 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DTKGNNELFLKEVFNTTNKYRAMHGCPAVTI------NAALNKLAQEWA--NHLRDQNTMAHRPN 79
            |.:.|...    :.:..|.||:....||..:      |..|.| |:|||  ...:..|....:..
 Frog    62 DLESNRNF----IVDKHNYYRSWVNPPAADMLKMHWDNYYLAK-AKEWALTCSFKHSNLSFRQYG 121

  Fly    80 PKY-GENIFLSGGMDVTGDLPVEMWYRE-IN-SYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVAR 141
            .:: |||| ::.....:.:..:..|:.| :| .|.....:.....|||||:||..:..:...||:
 Frog   122 GEFAGENI-MNSYFRHSWEYVINYWFNEHVNWEYAVGTTKEGAVTGHFTQIIWAPTHALACYVAK 185

  Fly   142 ---KADRTWVVCNYNPPGN 157
               .....:.||.|.|.||
 Frog   186 CYGTPYNYFYVCIYYPTGN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 36/141 (26%)
XB5812873XP_031758624.1 CAP 65..201 CDD:412178 34/141 (24%)
Crisp 219..269 CDD:400739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.