DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and R3hdml

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001092801.1 Gene:R3hdml / 100043899 MGIID:3650937 Length:253 Species:Mus musculus


Alignment Length:150 Identity:42/150 - (28%)
Similarity:59/150 - (39%) Gaps:34/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NKYRAMHGCPAVTI-----NAALNKLAQEWANHLRDQNTMAHRPNP--KY-GENIFL-SGGMDVT 95
            |..||....||..:     :..|.:.|:.||.    |....|.|:.  || |:|:.: ||.....
Mouse    71 NHIRASVHPPAANMEYMVWDEQLARSAEAWAT----QCIWTHGPSQLMKYVGQNLSIHSGRFRSV 131

  Fly    96 GDLPVEMWYREINSYDFNKAQFV----------PTAGHFTQLIWKSSVEMGSGVARKAD-----R 145
            .|| |..|..|...|.|...:..          |...|:||::|.||..:|..:...:.     .
Mouse   132 VDL-VRSWSEEKRHYSFPAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLGCAINTCSSINVWGN 195

  Fly   146 TW-----VVCNYNPPGNVVG 160
            ||     :||||...||.:|
Mouse   196 TWQQAVYLVCNYAIKGNWIG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 40/146 (27%)
R3hdmlNP_001092801.1 CAP_R3HDML 63..208 CDD:349409 38/141 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.