DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and LOC683849

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:253 Identity:84/253 - (33%)
Similarity:128/253 - (50%) Gaps:31/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLAVHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCI 72
            |:||   |:...|...::..::|:||.:.....||:||||. .|.||||||:.:...:::||||.
  Rat     5 LILA---LVGTAVAFPVDDDDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCY 65

  Fly    73 KE------GERSIRAGSSLHDSGGVVVGVEAY------IIHPQFDKHNMENDVAVLKLSSPLSFS 125
            |.      ||.:|          .|:.|.|.:      |.||.||:..:.||:.::|||||:..:
  Rat    66 KSRIQVRLGEHNI----------NVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLN 120

  Fly   126 DSIQTIPLAETDPPTSSSALATGWGRG-NFLI-RPRQLQGVEILIRPLIVCKLKYGNGVFNEDIC 188
            ..:.|:.|..:..|..:..|.:|||.. :|.: .|..||.::..:.|...|:..|...:.:..:|
  Rat   121 ARVATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVC 185

  Fly   189 AGRM--GKGGCYGDSGGPLVFNGQLVGITS-RTGNIVCLGSSLYASVARYRNWILSAI 243
            ||.:  ||..|.||||||:|.||:|.||.| ..|..:.....:|..|..|.:||...|
  Rat   186 AGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIEDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 76/226 (34%)
Tryp_SPc 30..239 CDD:238113 76/225 (34%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 76/226 (34%)
Tryp_SPc 24..242 CDD:238113 78/228 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.