DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and prss1

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:269 Identity:84/269 - (31%)
Similarity:127/269 - (47%) Gaps:53/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KCFHLLLAVHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITA 68
            |.| :|||: ..::...| |.:..::|:||.......||:||||. .|.||||||:.|...:::|
Zfish     2 KAF-ILLAL-FAVAYAAP-LGDDDDKIVGGYECTKNGVPYQVSLN-SGYHFCGGSLISNLWVVSA 62

  Fly    69 AHCIKE------GERSIRAGSSLHDSGGVVVGVEAY------IIHPQFDKHNMENDVAVLKLSSP 121
            |||.|.      ||.:|          .|..|.|.:      |.||.::.:.::|||.::||||.
Zfish    63 AHCYKSRVQVRLGEHNI----------DVTEGTEQFINSEKVIRHPSYNSNTLDNDVMLIKLSSS 117

  Fly   122 LSFSDSIQTIPLAETDPPTSSSALATGWGR-----GNFLIRPRQLQGVEILIRPLIVCKLKYGNG 181
            ...:..::|:.|..:...:.:|.|.:|||.     .|:   |.:|..:...|.....|:..|...
Zfish   118 AQINSYVKTVSLPSSCASSGTSCLISGWGNMSASGSNY---PSRLMCLNAPILSDSTCRNAYPGQ 179

  Fly   182 VFNEDICAGRM--GKGGCYGDSGGPLVFNGQLVGITS---------RTGNIVCLGSSLYASVARY 235
            :.:...|||.|  ||..|.||||||:|.|.||.||.|         :.|        :||.|..:
Zfish   180 ISSNMFCAGFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPG--------VYAKVCNF 236

  Fly   236 RNWILSAID 244
            ..||.:.::
Zfish   237 TTWIRNTMN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 75/237 (32%)
Tryp_SPc 30..239 CDD:238113 75/236 (32%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 75/237 (32%)
Tryp_SPc 25..243 CDD:238113 77/239 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.