DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG17242

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:237 Identity:80/237 - (33%)
Similarity:124/237 - (52%) Gaps:39/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKEGER---SIRAGSSLHDSGGVVVGVE 96
            |:.|...|||.|:|...:|.|||.|||:.||:|.|.|:::...   |:|.||:..::||.|:.||
  Fly    21 SIGIEQAPWQASVQINDKHHCGGVIYSEDIILTIAECVRKARLEFISVRVGSAQENAGGTVLKVE 85

  Fly    97 AYIIHPQFDKHNME------NDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALATGWGR---- 151
                     |..::      :|||:|:|.|||.....|:.||||.......::|..:|||:    
  Fly    86 ---------KMRLQVLGLRPSDVAILQLRSPLYLDGGIRAIPLATIPLVPGTNASVSGWGQLSAM 141

  Fly   152 ---GNFLIRPRQLQGVEILIRPLIVC----KLKYGNGVFNEDICAGRMGK--GGCYGDSGGPLVF 207
               ...|:|      |::.|:..::|    .|| |..:...:|||...|:  ..|.|..|||||.
  Fly   142 NPSSEVLLR------VDVKIQDQLMCATNLALK-GRLMSVGEICAAPAGEIPYACQGFVGGPLVA 199

  Fly   208 NGQLVGITS-RTGNIVCLGSSLYASVARYRNWILSAIDVLHF 248
            |.:|.||.| ::...|...||:||::|.::.||.|.:.:::|
  Fly   200 NNRLYGILSWQSACDVLNKSSVYANIAMFKVWIESTVKLMNF 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 76/226 (34%)
Tryp_SPc 30..239 CDD:238113 76/226 (34%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 77/226 (34%)
Tryp_SPc 24..232 CDD:214473 75/223 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.