DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG17239

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:259 Identity:96/259 - (37%)
Similarity:137/259 - (52%) Gaps:32/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSKCFHLLLAVHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTII 65
            ||.:...|..:|.::.|..:|      |||:||..:.|..||||.|:...|...||.:|||:.|:
  Fly     1 MFVQWIFLAFSVTVVSSNWIP------ERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIV 59

  Fly    66 ITAAHCIKEGER---SIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDS 127
            ||||||:.:.|.   |:|.|||....||.||.|.:.::|.::|: :..||:||::|.|.|....:
  Fly    60 ITAAHCLTDRETEFLSVRVGSSFTFFGGQVVRVSSVLLHEEYDQ-SWSNDIAVMRLQSKLRLGSA 123

  Fly   128 IQTIPLAETDPPTSSSALATGWG----RGNFLIRPRQLQGVEILIRPLIVCKLKYGNGVFNEDIC 188
            :..||||:|.|.:.|.|..:|||    :.|:   |..:....:.|.....|:..||..:..:.||
  Fly   124 VSVIPLADTPPASGSPATVSGWGAIGFKKNY---PMSILSASVDIVDQDQCRRSYGRKITKDMIC 185

  Fly   189 AGRMGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGS--------SLYASVARYRNWILSAID 244
            |...||..|.||||||||...:||||.|       .|.        .:||:||..:.|||.||:
  Fly   186 AAAPGKDACSGDSGGPLVSGNKLVGIVS-------FGKECAHPEYPGVYANVAELKPWILGAIE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 84/224 (38%)
Tryp_SPc 30..239 CDD:238113 83/223 (37%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 84/224 (38%)
Tryp_SPc 24..237 CDD:238113 83/223 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443133
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.