DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Klk4

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:229 Identity:72/229 - (31%)
Similarity:109/229 - (47%) Gaps:17/229 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKEGERSIRAGSSLH----- 86
            |.|||.|........|||.:|......||.|.:.....:::||||::|   |...|..||     
Mouse    29 SSRIIQGQDCSPHSQPWQAALFSEDGFFCSGVLVHPQWVLSAAHCLQE---SYIVGLGLHNLKGS 90

  Fly    87 -DSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALATGWG 150
             :.|..::.....|.||.|:..:..||:.::||:..:..|::|::||:|...|....:.|.:|||
Mouse    91 QEPGSRMLEAHLSIQHPNFNDPSFANDLMLIKLNESVIESNTIRSIPVATQCPTPGDTCLVSGWG 155

  Fly   151 RGNFLIRPRQLQGVEILIRPLIVCKLKYGNGVFNEDICA--GRMGKGGCYGDSGGPLVFNGQLVG 213
            :......|..||.|.:.:.....|:|.|.........||  |:..|..|.||||||:|.|..|.|
Mouse   156 QLKNGKLPSLLQCVNLSVASEETCRLLYDPVYHLSMFCAGGGQDQKDSCNGDSGGPIVCNRSLQG 220

  Fly   214 ITSRTGNIVCLGS----SLYASVARYRNWILSAI 243
            :.| .|...| |.    |:|.::.::.|||.:.|
Mouse   221 LVS-MGQGKC-GQPGIPSVYTNLCKFTNWIQTII 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 68/221 (31%)
Tryp_SPc 30..239 CDD:238113 67/220 (30%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 69/223 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.