DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and PRTN3

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:255 Identity:77/255 - (30%)
Similarity:114/255 - (44%) Gaps:43/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LISPVVPVLLEPSER---IIGGSSMDITDVPWQVSLQYY---GEHFCGGSIYSKTIIITAAHCIK 73
            |.|.::.:||..:.|   |:||........|:..|||..   |.|||||::...:.::|||||::
Human    10 LASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLR 74

  Fly    74 E----------GERSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSI 128
            :          |..::|..........|     |.:....:|..|..|||.:::||||.:.|.|:
Human    75 DIPQRLVNVVLGAHNVRTQEPTQQHFSV-----AQVFLNNYDAENKLNDVLLIQLSSPANLSASV 134

  Fly   129 QTIPLAETDPPT--SSSALATGWGRGNFLIRPRQ-LQGVEILI-----RPLIVCKLKYGNGVFNE 185
            .|:.|.:.|.|.  .:..||.||||......|.| ||.:.:.:     ||..:|..         
Human   135 ATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTF--------- 190

  Fly   186 DICAGRMGKGGCYGDSGGPLVFNGQLVGITSRT--GNIVCLGSSLYASVARYRNWILSAI 243
               ..|...|.|:|||||||:.:|.:.||.|..  |....|....:..||.|.:||.|.:
Human   191 ---VPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 70/235 (30%)
Tryp_SPc 30..239 CDD:238113 69/231 (30%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 71/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.