DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:192 Identity:53/192 - (27%)
Similarity:79/192 - (41%) Gaps:54/192 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GVVVGVEAY------IIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALA-- 146
            |...|.|.|      |.||.:::.....|:.::|||:|:..:..:...||    |..::..||  
Zfish    14 GANEGTEQYSKPLMLIPHPLYNRSTNNADIMLIKLSAPIELNRYVSLAPL----PKQNTGLLAGR 74

  Fly   147 ----TGWG----RGNFLIRPRQLQGVEILIRPLIVC--KLKYGNGVFNEDICAGRMGKGG----- 196
                :|||    .|..:  |..|:.|.:.|.....|  ...:...:....|||| ...||     
Zfish    75 MCRVSGWGSTSHSGGLI--PLTLRTVRLPIVSTFKCNSSSSFSGNITANMICAG-SSTGGKDACK 136

  Fly   197 -------------CYGDSGGPLVFNGQLVGITSRTGNIVCLG------SSLYASVARYRNWI 239
                         |.||||||||.:|::.|:.| .||    |      ..:|.:|:|:|.||
Zfish   137 NSTQYLCHLIVYLCQGDSGGPLVCDGRVYGLVS-WGN----GCGDPRFPGVYTAVSRFRRWI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 51/190 (27%)
Tryp_SPc 30..239 CDD:238113 51/190 (27%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 53/192 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.