DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and prss1

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001015792.1 Gene:prss1 / 548509 XenbaseID:XB-GENE-5776262 Length:244 Species:Xenopus tropicalis


Alignment Length:247 Identity:81/247 - (32%)
Similarity:123/247 - (49%) Gaps:32/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VVPVLL------EPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKE--- 74
            :|.|||      |..::|:||.:.....||:||||. .|.||||||:.:...:::||||.|.   
 Frog     5 IVLVLLGAAVAFEDDDKIVGGFTCTKNAVPYQVSLN-AGYHFCGGSLINSQWVVSAAHCYKSRIQ 68

  Fly    75 ---GERSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAET 136
               ||.:|    ::::.....:..:..|.||.::..|::||:.::|||:....|.:||::||...
 Frog    69 VRLGEHNI----AVNEGTEQFIESQKVIKHPSYNSRNLDNDIMLIKLSTTARLSSNIQSVPLPSA 129

  Fly   137 DPPTSSSALATGWGR-----GNFLIRPRQLQGVEILIRPLIVCKLKYGNGVFNEDICAGRM--GK 194
            .....::.|.:|||.     .|:   |..||.:...|.....|...|...:.|...|||.:  ||
 Frog   130 CASAGTNCLISGWGNTLSSGTNY---PDLLQCLNAPILTASECSNSYPGEITNNMFCAGFLAGGK 191

  Fly   195 GGCYGDSGGPLVFNGQLVGITSRTGNIVCLGSS---LYASVARYRNWILSAI 243
            ..|.||||||:|.||||.|:.|  ....|...:   :|..|..|.:||.:.|
 Frog   192 DSCQGDSGGPVVCNGQLQGVVS--WGYGCAQRNYPGVYTKVCNYVSWIQNTI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 73/225 (32%)
Tryp_SPc 30..239 CDD:238113 73/224 (33%)
prss1NP_001015792.1 Tryp_SPc 22..240 CDD:238113 75/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.