DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Cma2

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001019885.1 Gene:Cma2 / 545055 MGIID:88426 Length:246 Species:Mus musculus


Alignment Length:245 Identity:70/245 - (28%)
Similarity:108/245 - (44%) Gaps:33/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLEPS----ERIIGGSSMDITDVPWQVSLQYYGEH----FCGGSIYSKTIIITAAHC------IK 73
            ||.||    |.||||...:....|:...:..:...    .|||.:.:...::|||||      :.
Mouse    10 LLLPSRAGAEEIIGGVESEPHSRPYMAYVNTFRRKGYVAICGGFLITPQFVMTAAHCSGRRMTVT 74

  Fly    74 EGERSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPL-AETD 137
            .|..::|........    :.||.||:.|.::..:..||:.:|||....:.:.::..:|| |.:|
Mouse    75 LGAHNVRKRECTQQK----IKVEKYILPPNYNVSSKFNDIVLLKLKKQANLTSAVDVVPLPAPSD 135

  Fly   138 ---PPTSSSALATGWGR-GNFLIRPRQLQGVEILIRPLIVCKL--KYGNGVFNEDICAGRMGK-G 195
               |.|  ...|.|||| |......|.|:.||:.|.....||:  .|.:.:   .||.|...| .
Mouse   136 FAKPGT--MCWAAGWGRTGLKKSISRTLREVELRIMGKKACKIFKHYKDSL---QICVGSSTKVA 195

  Fly   196 GCY-GDSGGPLVFNGQLVGITSRTGNIVCLGSSLYASVARYRNWILSAID 244
            ..| |||||||:..|...||.| :|.......:::..::.:..||...|:
Mouse   196 SVYMGDSGGPLLCAGVAHGIVS-SGRGNAKPPAIFTRISPHVPWINRVIE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 62/228 (27%)
Tryp_SPc 30..239 CDD:238113 62/227 (27%)
Cma2NP_001019885.1 Tryp_SPc 20..239 CDD:214473 62/228 (27%)
Tryp_SPc 21..242 CDD:238113 64/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.