DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Mcpt10

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_058842.2 Gene:Mcpt10 / 54269 RGDID:3063 Length:248 Species:Rattus norvegicus


Alignment Length:264 Identity:73/264 - (27%)
Similarity:117/264 - (44%) Gaps:44/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLAVHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQ-YYG---EHFCGGSIYSKTIIITA 68
            :.|.:..|:: ::||..|..| ||.|:.......|:..||. |||   .|:|||.:.:|.|::||
  Rat     1 MFLFLFFLVA-ILPVNTEGGE-IIWGTESKPHSRPYMASLMFYYGNSYRHYCGGFLVAKDIVMTA 63

  Fly    69 AHC-------------IKEGERSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSS 120
            |||             ||:.|::            .|:.|.....|..:|:|:..||:.:|||..
  Rat    64 AHCNGSNIKVTLGAHNIKKQEKT------------QVIAVVKAKPHENYDRHSRFNDIMLLKLER 116

  Fly   121 PLSFSDSIQTIPLAETDPPTSSSALAT--GWGRGNFLIRPRQLQGVEILIRPLIVCKLKYGNGVF 183
            ....:.:::||.|..:........:.|  |||..........||.|.:.::....|:....|  :
  Rat   117 KAQLNGAVKTIALPRSQDWVKPGQVCTVAGWGCLANCSLSNTLQEVNLEVQEGQKCEDMSRN--Y 179

  Fly   184 NEDI--CAGR--MGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGS--SLYASVARYRNWILSA 242
            |:.|  |.|.  .||....||||||.|.:|...||.|..   :|.|:  .::..::.:..||...
  Rat   180 NDSIQLCVGNPSEGKATGKGDSGGPFVCDGVAQGIVSYR---LCTGTLPRVFTRISSFIPWIQKT 241

  Fly   243 IDVL 246
            :.:|
  Rat   242 MKLL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 64/234 (27%)
Tryp_SPc 30..239 CDD:238113 64/233 (27%)
Mcpt10NP_058842.2 Tryp_SPc 21..241 CDD:238113 66/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.