DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Elane

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:256 Identity:77/256 - (30%)
Similarity:114/256 - (44%) Gaps:43/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLAVHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCI 72
            :|||:.|    ..|.|   :..|:||........|:..|||..|.||||.::.::..:::||||:
Mouse    14 MLLALFL----GGPAL---ASEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCV 71

  Fly    73 KE-GERSIRAGSSLHDSGGVVVGVEAY----IIHPQFDKHNMENDVAVLKLSSPLSFSDSIQT-- 130
            .. ..||::.....||........:.:    |....||...:.||:.:::|:...:.:.::|.  
Mouse    72 NGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQ 136

  Fly   131 IPLAETDPPTSSSALATGWGR-GNFLIRPRQLQGVEILI------RPLIVCKLKYGNGVFNEDIC 188
            :|.........:..||.|||| |.....|..||.:.:.:      |.:.||.|            
Mouse   137 LPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTNMCRRRVNVCTL------------ 189

  Fly   189 AGRMGKGGCYGDSGGPLVFNGQLVGITS--RTGNIVCLGSSLY----ASVARYRNWILSAI 243
            ..|...|.|:||||||||.|..:.||.|  |.|   | ||.||    |.||.:.:||.|.|
Mouse   190 VPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGG---C-GSGLYPDAFAPVAEFADWINSII 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 67/229 (29%)
Tryp_SPc 30..239 CDD:238113 67/228 (29%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 67/229 (29%)
Tryp_SPc 29..245 CDD:238113 69/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.