DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Prss53

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:312 Identity:78/312 - (25%)
Similarity:127/312 - (40%) Gaps:89/312 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLISPVVPVL--LEPSERIIG-----------GSSMDITDVPWQVSLQYYGEHFCGGSIYSKTII 65
            |||...|.|:  |:.::|..|           |:::. .:.|||.|::..|.|.|.||:.:.|.:
  Rat     9 LLIVGAVIVIEGLQAAQRACGQRGPGPPEPQEGNTLP-GEWPWQASVRRQGVHICSGSLVADTWV 72

  Fly    66 ITAAHCIKE------GERSIRAGSSLHDS---GGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSP 121
            :|||||.::      ...|:..||...:.   |...|||.|..:...::.::..:|:|:|:|:.|
  Rat    73 LTAAHCFEKMATAELSSWSVVLGSLKQEGLSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLTHP 137

  Fly   122 LSFSDSIQT---IPLAETDPPTSSSALATGWGR----GNFLIR--PRQLQGVEIL---------- 167
            :     :.|   :|......|..:|..||||.:    |.:..|  .|:.|...:|          
  Rat   138 I-----VHTTLCLPQPTHHFPFGASCWATGWDQNTSDGKYCPRHKSRESQTGSVLTVLALCSHCV 197

  Fly   168 ------IRPLIV----------------CKLKY--------GNGVFNEDICAGRMG--KGGCYGD 200
                  :.||.|                |...|        .|...:..:|.|...  :|.|.||
  Rat   198 SELDSTLSPLPVSRTLRNLRLRLISRPTCNCLYNRLHQRLLANPARSGMLCGGAQPGVQGPCQGD 262

  Fly   201 SGGPLVF---NGQ--LVGITSRTGNIVCLGSS---LYASVARYRNWILSAID 244
            ||||::.   :|.  .|||.|.|.|  |....   |...:|.:.:|:.:.:|
  Rat   263 SGGPVMCREPDGHWVQVGIISFTSN--CAQEDTPVLLTDMAAHSSWLQAHVD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 70/288 (24%)
Tryp_SPc 30..239 CDD:238113 69/287 (24%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 68/272 (25%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.