DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Prss36

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:296 Identity:89/296 - (30%)
Similarity:127/296 - (42%) Gaps:80/296 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAVHLLISPVVPV----------------------LLEPSERIIGGSSMDITDVPWQVSLQYYGE 52
            |..||:.|.|.|.                      ..|||.||:|||.......||||||.:.|.
  Rat    17 LTPHLVFSVVSPTPGAFQDSAVSPTQGEFEDLDCGRPEPSSRIVGGSDAHPGTWPWQVSLHHGGG 81

  Fly    53 HFCGGSIYSKTIIITAAHC-IKEG------ERSIRAGSSLHDSGGVVVG-----VEAYIIHPQFD 105
            |.||||:.:.:.:::|||| :..|      |.|:..|  :|...|.:.|     |...::...:.
  Rat    82 HICGGSLIAPSWVLSAAHCFVTNGTLEPADEWSVLLG--VHSQDGPLEGAHMRSVATILVPDNYS 144

  Fly   106 KHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTS------SSALATGWG---RGNFLIRPRQL 161
            :..:..|:|:|:|:||.....|::.:.|    |..|      ::..|||||   ..:.|..|..|
  Rat   145 RVELGADLALLRLASPAKLGPSVKPVCL----PRASHLFAHGTACWATGWGDVQESDPLPVPWVL 205

  Fly   162 QGVEILIRPLIVCKLKYGN-GVFNED-------ICAG--RMGKGGCYGDSGGPLVF--NGQ--LV 212
            |.||:.:.....|:..|.. |.||..       :|||  ...:..|.||||||||.  .|:  |.
  Rat   206 QEVELKLLGETACQCLYSRPGPFNLTLQLLPGMLCAGYPEGRRDTCQGDSGGPLVCEDGGRWFLA 270

  Fly   213 GITS---------RTGNIVCLGSSLYASVARYRNWI 239
            ||||         |.|        ::.:||.|.:||
  Rat   271 GITSFGFGCGRRNRPG--------VFTAVAHYESWI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 78/253 (31%)
Tryp_SPc 30..239 CDD:238113 77/252 (31%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 79/254 (31%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.