DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and epsilonTry

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:249 Identity:96/249 - (38%)
Similarity:140/249 - (56%) Gaps:18/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FHLLLAV-HLLISPVVP--VLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIIT 67
            |.:||:| ...::..:|  :|.:...||:||....|...|:|||||.||.|||||||||..|:||
  Fly     4 FAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVIT 68

  Fly    68 AAHCIKEGER---SIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQ 129
            ||||::..|.   .||.||:...|||.|..|.::..|..::...|.||:|::::.|.|||..||:
  Fly    69 AAHCLQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIR 133

  Fly   130 TIPLAETDPPTSSSALATGWG---RGNFLIRPRQLQGVEILIRPLIVCK---LKYGNGVFNEDIC 188
            .|.:|:::|...::|:.:|||   .|...| |..|..|::.|..:..|:   ..||..:.:..:|
  Fly   134 EIRIADSNPREGATAVVSGWGTTESGGSTI-PDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLC 197

  Fly   189 AGRMGKGGCYGDSGGPLVFNGQLVGITS---RTGNIVCLGSSLYASVARYRNWI 239
            |....|..|.||||||||...:|||:.|   ..|::...|  :||.||.:..||
  Fly   198 AYAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPG--VYADVAHFHEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 88/221 (40%)
Tryp_SPc 30..239 CDD:238113 87/220 (40%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 88/221 (40%)
Tryp_SPc 31..252 CDD:238113 89/222 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452447
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.