DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and alphaTry

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster


Alignment Length:248 Identity:111/248 - (44%)
Similarity:143/248 - (57%) Gaps:17/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLAVHLLISPVVPVLLEP--SERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAH 70
            ||.||...:...||..|.|  ..||:|||:..|:..|||:|||..|.|.|||||||..||:||||
  Fly     7 LLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAH 71

  Fly    71 CIKEGERS---IRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIP 132
            |::....|   :||||:...|||||..|.::..|..::.:.|.||:||::|||.||||.||:.|.
  Fly    72 CLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAIS 136

  Fly   133 LAETDPPTSSSALATGWG---RGNFLIRPRQLQGVEILIRPLIVCKLK---YGNGVFNEDICAGR 191
            ||..:|...:||..:|||   .|:..| |.|||.|.:.|.....|...   ||:.:.|..|||..
  Fly   137 LATYNPANGASAAVSGWGTQSSGSSSI-PSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAA 200

  Fly   192 MGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGSS---LYASVARYRNWILS 241
            .||..|.||||||||..|.|||:.|  ....|..|:   :||.||..|:|::|
  Fly   201 SGKDACQGDSGGPLVSGGVLVGVVS--WGYGCAYSNYPGVYADVAVLRSWVVS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 101/221 (46%)
Tryp_SPc 30..239 CDD:238113 100/220 (45%)
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 101/221 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443186
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.