DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and KLK12

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:227 Identity:66/227 - (29%)
Similarity:101/227 - (44%) Gaps:34/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAVHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHF-CGGSIYSKTIIITAAHC-- 71
            |::.||:. |:.:....:.:|..|:.......||||.| :.|... |||.:.....::|||||  
Human     3 LSIFLLLC-VLGLSQAATPKIFNGTECGRNSQPWQVGL-FEGTSLRCGGVLIDHRWVLTAAHCSG 65

  Fly    72 ----IKEGERSIRA---GSSLHDSGGVVVGVEAYIIHPQF----DKHNMENDVAVLKLSSPLSFS 125
                ::.||.|:..   ...:..||..|.       ||.:    ..|  |:|:.:|:|..|:..:
Human    66 SRYWVRLGEHSLSQLDWTEQIRHSGFSVT-------HPGYLGASTSH--EHDLRLLRLRLPVRVT 121

  Fly   126 DSIQTIPLAETDPPTSSSALATGWGRGNFLIRPRQ-----LQGVEILIRPLIVCKLKYGNGVFNE 185
            .|:|.:||........:....:|||..|   .||.     ||.:.:.|.....|...|...:.:.
Human   122 SSVQPLPLPNDCATAGTECHVSGWGITN---HPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSN 183

  Fly   186 DICAGRM-GKGGCYGDSGGPLVFNGQLVGITS 216
            .:|||.: |:..|.||||||||..|.|.|:.|
Human   184 MVCAGGVPGQDACQGDSGGPLVCGGVLQGLVS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 62/208 (30%)
Tryp_SPc 30..239 CDD:238113 62/207 (30%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 62/208 (30%)
Tryp_SPc 22..236 CDD:238113 62/207 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.