DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG34130

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:255 Identity:60/255 - (23%)
Similarity:101/255 - (39%) Gaps:67/255 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKEGERS--------IRAGSSL 85
            |..||.:     |||.:.:.......||.|..|....:|:|:|: ...||        :.:..|.
  Fly    48 RTSGGHA-----VPWLLRIVDGPTFVCGASYLSALYALTSANCM-HSHRSQMESLSVELVSSDSR 106

  Fly    86 HDSGGVVVGVEAYIIHPQFDKHNMEN-------------------DVAVLKLSSPLSFSDSIQTI 131
            .|:              |.|.|:..|                   ||||::|::.|. .:....:
  Fly   107 QDN--------------QLDSHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLR-GNRNNYV 156

  Fly   132 PLAETDPPTSSSALA-TGWGRGNFLIRPRQ---LQGVEILIRPLIVCKLKYGNGVFNEDI-CAGR 191
            .|. |:|.:|..:|: ..:|.|     |.:   .:.:|:|.|  ::|...|||.:..|.: ||..
  Fly   157 TLC-TNPLSSYKSLSVVSYGAG-----PAENVRTEEIEVLNR--MICDSAYGNFLLRETVACAKE 213

  Fly   192 MGKGG-CYGDSGGPLVFNGQLVGITSRTGNIVCLGSSL---YASVARYRNWILSAIDVLH 247
            ..:.. |...:|.|:....||.||.:  .:..|..|:|   :..:.:.:.:||.||...|
  Fly   214 FKRSADCMFSAGCPVTAGDQLCGIVA--WSPACKRSNLPGIFTDIHQVKRFILKAISGKH 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 55/245 (22%)
Tryp_SPc 30..239 CDD:238113 54/244 (22%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 52/240 (22%)
Tryp_SPc 53..256 CDD:304450 52/233 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.