DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Gm5771

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:233 Identity:78/233 - (33%)
Similarity:120/233 - (51%) Gaps:28/233 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKE------GERSIRAGSSLH 86
            ::|:||.:.....||:||||. .|.||||||:.:...:::||||.|.      ||.:|:      
Mouse    21 DKIVGGYTCRENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCYKTRIQVRLGEHNIK------ 78

  Fly    87 DSGGVVVGVEAY------IIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSAL 145
                |:.|.|.:      |.||.|::..:.||:.::|||||::.:..:.|:.|..:..|..:..|
Mouse    79 ----VLEGNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVATVALPSSCAPAGTQCL 139

  Fly   146 ATGWGRG-NF-LIRPRQLQGVEILIRPLIVCKLKYGNGVFNEDICAGRM--GKGGCYGDSGGPLV 206
            .:|||.. :| :..|..||.::..:.|...|:..|...:....:|||.:  ||..|.||||||:|
Mouse   140 ISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYPGKITGNMVCAGFLEGGKDSCQGDSGGPVV 204

  Fly   207 FNGQLVGITS-RTGNIVCLGSSLYASVARYRNWILSAI 243
            .||:|.||.| ..|..:.....:|..|..|.:||...|
Mouse   205 CNGELQGIVSWGYGCALADNPGVYTKVCNYVDWIQDTI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 75/226 (33%)
Tryp_SPc 30..239 CDD:238113 75/225 (33%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 75/226 (33%)
Tryp_SPc 23..241 CDD:238113 77/228 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.