DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG34129

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:225 Identity:57/225 - (25%)
Similarity:93/225 - (41%) Gaps:45/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GEHFCGGSIYSKTIIITAAHCIKEGERSIRAGSSLHDSGGVVVGV-------EAY-----IIHPQ 103
            |...||.:.|:..::||:|:||.....|:        .|..|.|.       |.|     |..|:
  Fly    64 GNFACGAAYYAPLLVITSANCIYPYRNSL--------EGATVEGTAFSECDRENYADIDTIQFPE 120

  Fly   104 -FDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALATGWGRGNFLIR-----PRQLQ 162
             |....:..||||::|..|:. ....:.|.|...........:..|||..|..:.     ||   
  Fly   121 KFIYQKLYMDVAVVRLRDPVR-GRLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVEIPSSDPR--- 181

  Fly   163 GVEILIRPLIVCKLKYGN-GVFNEDICAGRMGKG--GCYGDSGGPLVFNGQLVGITSRTGNIVCL 224
            .|.:.|..:..|:.|:.: .:.:..||| |..|.  .|..|.|.||::..:|.|:.|...:  |:
  Fly   182 NVTVTIISIKECRQKFKSPKIASTSICA-RQPKNPKQCLYDGGSPLIYGRELCGVVSFGSH--CI 243

  Fly   225 GSS---LYASVARYRNWI------LSAIDV 245
            .:|   :|.::.|.:.:|      ::|.||
  Fly   244 DTSRPGMYTNIRRVKRFITETEESINAGDV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 53/211 (25%)
Tryp_SPc 30..239 CDD:238113 53/211 (25%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 53/211 (25%)
Tryp_SPc 55..261 CDD:304450 53/211 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.