DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG31266

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:247 Identity:79/247 - (31%)
Similarity:114/247 - (46%) Gaps:45/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PSERIIGGSSMDITDVPWQVSLQ-YYGEHFCGGSIYSKTIIITAAHCIKEGERSIRAGSSLHDSG 89
            |..|:|||::....:.||..|:| .|..|.||..|..:|.::|||.|:    ..:|..:.|    
  Fly    48 PQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCV----AGLRPLNLL---- 104

  Fly    90 GVVVG-------------VEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTS 141
             ||.|             |....:|..|||....||:|:|:|||.:.|:|..:.|.||:.|....
  Fly   105 -VVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEE 168

  Fly   142 SSALA-TGWGRGNFL-IRPRQLQGVEILIRPLIVCKLKYGNGVFNEDICAGRM------GKGGCY 198
            ...|. .|||....: ...|.||.......|:..|:.|..|   .:|:..|.:      |:|.|:
  Fly   169 GDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQN---QDDVDLGHVCVQMDAGQGACH 230

  Fly   199 GDSGGPLVFNGQ-LVGITSRTGN--IVCLG---SSLYASVARYRNWILSAID 244
            ||:||||:...| ||||    ||  :.| |   ..:||..|.|.:||.:.::
  Fly   231 GDTGGPLIDEQQRLVGI----GNWGVPC-GRGYPDVYARTAFYHDWIRTTMN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 76/237 (32%)
Tryp_SPc 30..239 CDD:238113 75/236 (32%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 76/237 (32%)
Tryp_SPc 52..275 CDD:238113 77/239 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.