DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG4053

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:222 Identity:70/222 - (31%)
Similarity:113/222 - (50%) Gaps:13/222 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIIGGSSMDITDVPWQVSLQ-YYGEHFCGGSIYSKTIIITAAHCIK----EGERSIRAGSSLHDS 88
            ||:||...:....|:|||:| .:..|.|.|.|.::..|:||.||..    |..|.|...:...:.
  Fly    34 RIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEP 98

  Fly    89 GGVVVGVEAYIIHPQFD-KHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALATGWGRG 152
            |..:...|| ::|..:| .:...||:|::.::..:.|:|..|.:.|:...||..|:...||||..
  Fly    99 GQTLFPDEA-LVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTVTLTGWGAP 162

  Fly   153 NFLIRPRQ-LQGVEILIRPLIVCKLK--YGNGVFNEDICA-GRMGKGGCYGDSGGPLVFNGQLVG 213
            .......| ||.:.:.|.....|:.:  :.:|:....||. .|.|:|.|.|||||||::.|:|||
  Fly   163 ESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKLVG 227

  Fly   214 ITSRTGNIVCLG-SSLYASVARYRNWI 239
            :.: .|....:| ..:||:...|::||
  Fly   228 LVN-WGRACGVGMPDMYANTVYYQDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 68/220 (31%)
Tryp_SPc 30..239 CDD:238113 67/219 (31%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 68/220 (31%)
Tryp_SPc 35..256 CDD:238113 69/221 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.