DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG10587

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:271 Identity:67/271 - (24%)
Similarity:115/271 - (42%) Gaps:55/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ISPVVPVLLEP--SERIIGGSSMDITDVP----WQVSLQYYGEHFCGGSIYSKTIIITAAHC--- 71
            ::.:..::..|  ..|::||   |:|...    :.::|:|.....|||::....|::|||||   
  Fly    30 VNKLAKIVQRPGFQTRVVGG---DVTTNAQLGGYLIALRYEMNFVCGGTLLHDLIVLTAAHCFLG 91

  Fly    72 -IKEGERSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAE 135
             :|..:.....|:|..:..|:...|:..|...:|.:.:|..|||:|:|..|:. ..|:..:.|.:
  Fly    92 RVKISDWLAVGGASKLNDRGIQRQVKEVIKSAEFREDDMNMDVAILRLKKPMK-GKSLGQLILCK 155

  Fly   136 TDPPTSSSALATGWGRGNFLIRPRQLQGVEILIRPLIV-------CKLKY--------------- 178
            ......:....:|||     :......|.:.|:|.:.|       |:..|               
  Fly   156 KQLMPGTELRVSGWG-----LTENSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLFL 215

  Fly   179 ----GNGVFNEDICAGRMG-KGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGS---SLYASVARY 235
                .:.:|    |||.:| |..|..|||||||:..|:.||.|  ..|.|...   .:|..:...
  Fly   216 KVHLTDSMF----CAGVLGKKDACTFDSGGPLVYKNQVCGIVS--FGIGCASKRYYGVYTDIMYV 274

  Fly   236 RNWILSAIDVL 246
            :.:|..:|.||
  Fly   275 KPFIEQSIKVL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 62/247 (25%)
Tryp_SPc 30..239 CDD:238113 61/246 (25%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 62/247 (25%)
Tryp_SPc 46..280 CDD:238113 62/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.