DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG32374

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:231 Identity:77/231 - (33%)
Similarity:117/231 - (50%) Gaps:31/231 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCI--KEGERSIRAGSSLHDSGGV 91
            ||:.|..:..:..|:|.:|.|.....||..|.::..|:||.||.  ..|..::||||:....||.
  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRYTVRAGSTQQRRGGQ 137

  Fly    92 VVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSA-----LATGWGR 151
            :..|:..:.||.:.::.|:||:.::||.:||:....:|.:.|    |.|.:..     ||:||| 
  Fly   138 LRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKL----PSTRTKRFPKCYLASGWG- 197

  Fly   152 GNFLIRPRQLQGVEILIRPLIVCKLK--------YGNG--VFNEDICAGRMGKGGCYGDSGGPLV 206
                :.....|.|:..:|.:||||:.        .|.|  ::.:.|||.|..:..|.||||||||
  Fly   198 ----LTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGGPLV 258

  Fly   207 FNGQLVGITSRTGNIVCLGS---SLYASVARYRNWI 239
            .||.|.||||  ..|.|..:   .:|.:|.:|..||
  Fly   259 HNGVLYGITS--FGIGCASAKYPGVYVNVLQYTRWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 75/229 (33%)
Tryp_SPc 30..239 CDD:238113 74/228 (32%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 75/229 (33%)
Tryp_SPc 74..295 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443303
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.