DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG32271

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:255 Identity:83/255 - (32%)
Similarity:123/255 - (48%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLAVHLLISPVVPVLL----EPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITA 68
            |.|.:||     :|:..    |.:.||:||..:||..||:.|:|:..|...||||:.:...::||
  Fly     4 LWLVLHL-----IPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTA 63

  Fly    69 AHCIKEGERS---IRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQT 130
            |||:|....|   :.||.:.....||..||:.......::...:.:|||||||.:|:| ...:.|
  Fly    64 AHCVKGIGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVST 127

  Fly   131 IPLAETDPPTSSSALATGWGRGNFLIRPR------QLQGVEILIRPLIVCKLKY--GNGVFNEDI 187
            |.|..|..........:|||:    |..|      |::.|::.:.|...|..:|  ...:.|...
  Fly   128 IELCNTSFKAGDLIKVSGWGQ----ITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMF 188

  Fly   188 CAGRMG-KGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGSS---LYASVARYRNWILSAI 243
            ||...| |..|.||||||.|:.|||.||.|  ..:.|...|   :|.:|...|::|..|:
  Fly   189 CASVPGVKDACEGDSGGPAVYQGQLCGIVS--WGVGCARKSSPGVYTNVKTVRSFIDKAL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 75/224 (33%)
Tryp_SPc 30..239 CDD:238113 74/223 (33%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 75/224 (33%)
Tryp_SPc 25..244 CDD:238113 75/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.