DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG32270

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:237 Identity:77/237 - (32%)
Similarity:114/237 - (48%) Gaps:23/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKEGERS---IRAG--- 82
            |..|.||:||...|:...|..|:::..|...||||:.:...::|||||:.:|..|   :|.|   
  Fly    25 LRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTY 89

  Fly    83 -SSLHDSGGVVVGVEAYIIHPQ-FDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSAL 145
             |.:.:|..|     ..|:.|. :.:..:::|||:|:|..||..|.: :.|.||...|...|...
  Fly    90 LSDMRNSRYV-----RKILMPSAYSRTTLDHDVALLQLKQPLQASIA-KPISLAVRSPRPGSFVR 148

  Fly   146 ATGWG--RGNFLIRPRQLQGVEILIRPLIVCKLKYG--NGVFNEDICAGRMG-KGGCYGDSGGPL 205
            .:|||  ..:....|.|||.|.:.:.|...|:..|.  ..:.:...||...| |..|.||||||:
  Fly   149 VSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLKDACAGDSGGPV 213

  Fly   206 V-FNGQLVGITS--RTGNIVCLGS-SLYASVARYRNWILSAI 243
            | .||.|||:.|  |........| .:|:.|:...:||...|
  Fly   214 VNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 72/226 (32%)
Tryp_SPc 30..239 CDD:238113 71/225 (32%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 72/226 (32%)
Tryp_SPc 31..254 CDD:238113 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.