DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG32833

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:229 Identity:65/229 - (28%)
Similarity:108/229 - (47%) Gaps:24/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKEGERS----IRAGSSLHDSGGV 91
            :||..::||..||..|:....:..|.|:||..:.|:||..|: :|..:    :|.||:....|.:
  Fly    39 LGGHPVNITTAPWIASISIKQKAKCDGAIYKLSHIVTAGKCV-DGFLNKVIRVRVGSTTRSDGVI 102

  Fly    92 VVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALATGWGRGNFLI 156
            .|.|....:|.:|....:.::||:|||..||..|.:||.|.||...|...:...|.||....:..
  Fly   103 EVAVCNITVHEKFTGQTVFHNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTANGWPSFRWWA 167

  Fly   157 ---------RPRQLQGVEI-LIRPL----IVCKLKYGNGVFNEDI-CAGRMGKGGCYGDSGGPLV 206
                     ...:||..|: |:.|.    :..:..:....|.:|: |..:..|..|....|.|:|
  Fly   168 MYWKKCLDDEAYKLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCTEKFAKEACSLAMGSPVV 232

  Fly   207 FNGQLVGITSRTGNIVCLG-SSLYASVARYRNWI 239
            .||:||||.::.|   |.. ..:|.::.:|::|:
  Fly   233 HNGKLVGIITKGG---CSEYPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 64/227 (28%)
Tryp_SPc 30..239 CDD:238113 64/227 (28%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 65/228 (29%)
Tryp_SPc 40..262 CDD:214473 64/225 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.