DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and tpr

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:261 Identity:80/261 - (30%)
Similarity:117/261 - (44%) Gaps:45/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SPVVPVLLEP-------------SERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITA 68
            :|..|.|..|             .:||:||...::...||...|.|.|..:|..|:.:...::||
  Fly   101 TPAPPTLNPPRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTA 165

  Fly    69 AHCIKEGERSIRAGSSL--HD-----SGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSD 126
            :||: .|.|..|....|  ||     ...:...|...|.||:::..|.:||:|::||..|:.|::
  Fly   166 SHCV-YGFRKERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNE 229

  Fly   127 SIQTIPLAETDPPTS---SSALATGWGR---GNFLIRPRQ--LQGVEILIRPLIVC-KLKYGNGV 182
            .:.  |:....|..|   .:.:.||||.   |.    |..  ||.|::.|.....| |.:|||.:
  Fly   230 VLH--PVCMPTPGRSFKGENGIVTGWGALKVGG----PTSDTLQEVQVPILSQDECRKSRYGNKI 288

  Fly   183 FNEDICAG--RMGKGGCYGDSGGPL--VFNG----QLVGITSRTGNIVCLG-SSLYASVARYRNW 238
            .:..:|.|  ..||..|.|||||||  |.:|    |:.|:.|........| ..:||.|.||..|
  Fly   289 TDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTW 353

  Fly   239 I 239
            |
  Fly   354 I 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 74/234 (32%)
Tryp_SPc 30..239 CDD:238113 73/233 (31%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 74/234 (32%)
Tryp_SPc 127..356 CDD:238113 75/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.