DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG11192

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:241 Identity:84/241 - (34%)
Similarity:130/241 - (53%) Gaps:28/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKE----GERSIRAGSSLHDSG 89
            ||:||....|.:.|:|||:|..|.|.|||:|.....::|||||.::    .:.::|.|||.|:||
  Fly    27 RIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSSEHESG 91

  Fly    90 GVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAE-TDPPTSSSAL-ATGWG-- 150
            |.|:.:...|.|..::..:.:||:|:|.|:..|:|::.:|.:|||. .||||:.:.| .:|||  
  Fly    92 GHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGFQ 156

  Fly   151 ------RGNFLIRPRQLQGVEILIRPLIVCKLKYGN--GVFNEDICAGRMGKGGCYGDSGGPLV- 206
                  .|...:.| ||:.|::.:.....|:..|..  .:....|||.|.|:..|.|||||||| 
  Fly   157 AEESAVSGEVGVSP-QLRFVDVDLVESNQCRRAYSQVLPITRRMICAARPGRDSCQGDSGGPLVG 220

  Fly   207 -----FNGQLVGITSRTGNIVCLGSS---LYASVARYRNWILSAID 244
                 ...:|.||.|  ..:.|...:   :|.:||.:|:||...:|
  Fly   221 YAAEEGPARLYGIVS--WGLGCANPNFPGVYTNVAAFRSWIDEQLD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 81/234 (35%)
Tryp_SPc 30..239 CDD:238113 80/233 (34%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 81/234 (35%)
Tryp_SPc 28..262 CDD:238113 82/236 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443269
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.