DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Ser8

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:258 Identity:98/258 - (37%)
Similarity:138/258 - (53%) Gaps:27/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLAVHLLI-----SPVVPVLLEPSE-----RIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSK 62
            ||:|..|.:     ..|:|:.|||..     ||:||::..|.|.|||||||..|.|||||||.|.
  Fly     3 LLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISN 67

  Fly    63 TIIITAAHCIKE----GERSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLS 123
            .||:|||||:..    ....|||||:....|||:|.|.|...|..::.::..||:.|::|.:.|:
  Fly    68 NIIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLT 132

  Fly   124 FSDSIQTIPLAETDPPTSSSALATGWGRGNFLIRPRQLQGVEILIRPLIVCKLK-----YGNGVF 183
            |..:|:.|.:|...|...|:|..:|||:.:   .........:.:...||.:.:     ||.|.|
  Fly   133 FGSTIKAITMASATPAHGSAASISGWGKTS---TDGPSSATLLFVDTRIVGRSQCGSSTYGYGSF 194

  Fly   184 NED--ICAGRMGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGS--SLYASVARYRNWILSA 242
            .:.  |||....|..|.||||||||..|||||:.| .|....:.:  .:||::|..|:|:|.|
  Fly   195 IKATMICAAATNKDACQGDSGGPLVSGGQLVGVVS-WGRDCAVANYPGVYANIAELRDWVLQA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 86/222 (39%)
Tryp_SPc 30..239 CDD:238113 85/221 (38%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 86/222 (39%)
Tryp_SPc 35..253 CDD:238113 85/221 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443201
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.