DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and iotaTry

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:256 Identity:105/256 - (41%)
Similarity:139/256 - (54%) Gaps:23/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAVHLLISPVVPVLL-------EPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIIT 67
            :||:.:::.|:.:||       |.:.||||||...|.:.|||||:|....|.|||.||||.||||
  Fly     1 MAVYGIVATVLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIIT 65

  Fly    68 AAHCIKEGERS-----IRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDS 127
            |.||:.  |||     :|.|:..|:.||.:|.|.||.:|.|||...:..|:|||:||:||:|..|
  Fly    66 AGHCLH--ERSVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLS 128

  Fly   128 IQTIPLAETDPPTSSSALATGWGRGNFLIRPRQLQGVEILIRPLIVC-KLKYGNG---VFNEDIC 188
            .:.|.||.|.|...::...||||..:.......||..::.|.....| ..|:|.|   |..|.||
  Fly   129 TRAINLASTSPSGGTTVTVTGWGHTDNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETIC 193

  Fly   189 AGRMGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGSS---LYASVARYRNWILSAIDVL 246
            |.......|.||||||||.:.|||||.|  ....|...:   :||.||..|.||:.|.:.:
  Fly   194 AASTDADACTGDSGGPLVASSQLVGIVS--WGYRCADDNYPGVYADVAILRPWIVKAANAI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 96/221 (43%)
Tryp_SPc 30..239 CDD:238113 95/220 (43%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 96/221 (43%)
Tryp_SPc 28..247 CDD:238113 97/222 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443176
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.