DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Try29F

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:267 Identity:87/267 - (32%)
Similarity:131/267 - (49%) Gaps:39/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSKCFHL----LLAVHLLISPVV--PVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSI 59
            |.....||    :|.|:|.:...|  |.|   ..||:||...:|.|:|:||||| ...||||||:
  Fly    10 MAKTILHLFIGGILLVNLSLGATVRRPRL---DGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSL 70

  Fly    60 YSKTIIITAAHCIKEGE----RSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLS- 119
            .::..::||||| .||.    ..:|.|||....||.:||::....||:||.:.::.|.::|:|. 
  Fly    71 IAQGWVLTAAHC-TEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEE 134

  Fly   120 -SPLSFSDSIQTIPLAETDPPTSSSALATGWGRGNFLIRPRQLQGVEILIRPLIV-------CKL 176
             |..:.:.:...:|..:.|....:..|.:|||      ..:..|....::|.:.|       |..
  Fly   135 YSAKNVTQAFVGLPEQDADIADGTPVLVSGWG------NTQSAQETSAVLRSVTVPKVSQTQCTE 193

  Fly   177 KYGN--GVFNEDICAG--RMGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGSS---LYASVAR 234
            .|||  .:.:..:|||  ..||..|.|||||||..:|.|.|:.|  ....|...:   :|:.|:.
  Fly   194 AYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVS--WGYGCARPNYPGVYSRVSA 256

  Fly   235 YRNWILS 241
            .|:||.|
  Fly   257 VRDWISS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 75/229 (33%)
Tryp_SPc 30..239 CDD:238113 74/228 (32%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 75/229 (33%)
Tryp_SPc 42..264 CDD:238113 77/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443299
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.