DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and PRSS53

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:302 Identity:68/302 - (22%)
Similarity:112/302 - (37%) Gaps:109/302 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKEGER------SIRAGSSLHDS---GGVVVGVEA 97
            |||.|::..|.|.|.||:.:.|.::|||||.::...      |:..||...:.   |...|||.|
Human    49 PWQASVRRQGAHICSGSLVADTWVLTAAHCFEKAAATELNSWSVVLGSLQREGLSPGAEEVGVAA 113

  Fly    98 YIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDP----PTSSSALATGWGR------- 151
            ..:...::.::..:|:|:|:|:.|.:.:      ||....|    |..:|..||||.:       
Human   114 LQLPRAYNHYSQGSDLALLQLAHPTTHT------PLCLPQPAHRFPFGASCWATGWDQDTSDGKC 172

  Fly   152 ------GNFLIRP------------------------------------RQLQGVEILIRPLIVC 174
                  |..|..|                                    |.|: :.::.||...|
Human   173 WPRLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLR-LRLISRPTCNC 236

  Fly   175 KLKYGNGVFNE-------------DICAGRMG--KGGCYGDSGGPLVF---NGQLVGITSRTGNI 221
                   ::|:             .:|.|...  :|.|.||||||::.   :|..|     ...|
Human   237 -------IYNQLHQRHLSNPARPGMLCGGPQPGVQGPCQGDSGGPVLCLEPDGHWV-----QAGI 289

  Fly   222 VCLGSS--------LYASVARYRNWILSAIDVLHF--QAPAT 253
            :...||        |..:.|.:.:|:.:.:....|  |:|.|
Human   290 ISFASSCAQEDAPVLLTNTAAHSSWLQARVQGAAFLAQSPET 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 63/284 (22%)
Tryp_SPc 30..239 CDD:238113 63/284 (22%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 64/285 (22%)
Tryp_SPc 43..314 CDD:214473 63/283 (22%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149433
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.