DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG31954

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:267 Identity:95/267 - (35%)
Similarity:140/267 - (52%) Gaps:37/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KCFHLLLA-VHLLISPVV-----------PVLLEP--SERIIGGSSMDITDVPWQVSLQYYGEHF 54
            :|..|:|| |.|:..||.           |..|.|  ..||:||..::|||.|.||||| ...|.
  Fly    11 QCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQ-TSSHI 74

  Fly    55 CGGSIYSKTIIITAAHCI--KEGER-SIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVL 116
            |||||.|:..|:|||||.  |..:| .:|.|:|.....|.::.|:..:.|.||:..|::.|.::|
  Fly    75 CGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLL 139

  Fly   117 KLSSPLSFSDSIQTIPLAETDPP--TSSSALATGWGRGNFLIRPRQ-LQGVEILIRPLI---VCK 175
            :|:.|:.|.::.:.:.|.|:...  ...:...:|||....|:..|: |:.||:   ||:   :|.
  Fly   140 QLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEV---PLVNQELCS 201

  Fly   176 LKYG--NGVFNEDICAGRM--GKGGCYGDSGGPLVF-NGQLVGITSRTGNIVCLG---SSLYASV 232
            .||.  .||....||||.:  ||..|.||||||:|. :|:|||:.|  ....|..   ..:|:.|
  Fly   202 EKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVS--WGYGCAKPDYPGVYSRV 264

  Fly   233 ARYRNWI 239
            :..|:||
  Fly   265 SFARDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 82/226 (36%)
Tryp_SPc 30..239 CDD:238113 81/225 (36%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 82/226 (36%)
Tryp_SPc 51..274 CDD:238113 83/227 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443298
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.