DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG4271

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:196 Identity:64/196 - (32%)
Similarity:97/196 - (49%) Gaps:11/196 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GEHFCGGSIYSKTIIITAAHCIKE---GERSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMEND 112
            |.|.|||::....|::|||.|:|.   ...::|.|:.....||.::.|.|.::|..:  .|.:||
  Fly    40 GYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGGRIIRVTALVVHENY--KNWDND 102

  Fly   113 VAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALATGWGR---GNFLIRPRQLQGVEILIRPLIVC 174
            :|:|.|..|: .|..:..||||..:|..:......|||.   .:::: .|:||.....|||..:|
  Fly   103 IALLWLEKPV-LSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVV-TRKLQNGVTKIRPRSMC 165

  Fly   175 KLKYGNGVFNEDICAGRMGKGGCYGDSGGPLVFNGQLVGITSR-TGNIVCLGSSLYASVARYRNW 238
            ..:....|..|.:||.......|.||.|||||...::|||..: .|....:..|||.:|..|..|
  Fly   166 AEELVEPVGEELLCAFYTENDICPGDYGGPLVLANKVVGIAVQGHGCGFAVLPSLYTNVFHYLEW 230

  Fly   239 I 239
            |
  Fly   231 I 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 62/194 (32%)
Tryp_SPc 30..239 CDD:238113 62/194 (32%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 64/196 (33%)
Tryp_SPc 19..231 CDD:214473 62/194 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.