DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG11911

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:233 Identity:72/233 - (30%)
Similarity:104/233 - (44%) Gaps:26/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IIGGSSMDITDVPWQVSL--QYY-GEHFCGGSIYSKTIIITAAHCIKEG-ERSIRAGSSLHDSGG 90
            :|.|:..:....|:.|||  .|. ..|.|||::.:|..|:||||||.|. ..||.||  ||....
  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGMSIIAG--LHTRAE 99

  Fly    91 V-----VVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALATGWG 150
            |     ...|:...:|.::.......|:|:|.::....|::.:|...|...:..........|||
  Fly   100 VDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWG 164

  Fly   151 RGNFLI--RPRQLQGVEILIRPLIVCK--LKYGNGVFNEDICAG--RMGKGGCYGDSGGPLVFN- 208
            :....|  ..:.||.|...|.....||  |.....:...:||:.  :..|..|.||||||||.. 
  Fly   165 QPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEF 229

  Fly   209 ----GQLVGITSRTGNIVC-LGS--SLYASVARYRNWI 239
                .:|:||.| .|.|.| |.:  |:|..|:.|.:||
  Fly   230 TNAPSELIGIVS-WGYIPCGLANMPSIYTKVSAYIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 70/231 (30%)
Tryp_SPc 30..239 CDD:238113 70/231 (30%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 72/233 (31%)
Tryp_SPc 37..266 CDD:214473 70/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.