DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Prss53

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:283 Identity:75/283 - (26%)
Similarity:124/283 - (43%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLISPVVPVL--LEPSERIIG-----------GSSMDITDVPWQVSLQYYGEHFCGGSIYSKTII 65
            |||...|.|:  |:.::|..|           |:::. .:.|||.|::..|.|.|.||:.:.|.:
Mouse     9 LLIVGAVVVIEGLQAAQRACGQRGPGPPEPQEGNTLP-GEWPWQASVRRQGVHICSGSLVADTWV 72

  Fly    66 ITAAHCIKE------GERSIRAGSSLHDS---GGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSP 121
            :|||||.::      ...|:..||...:.   |...|||.|..:...::.::..:|:|:|:|:.|
Mouse    73 LTAAHCFEKMATAELSSWSVVLGSLKQEGQSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLTHP 137

  Fly   122 LSFSDSIQT---IPLAETDPPTSSSALATGWGRGNFLIRPRQLQGVEILIRPLIVCKLKY----- 178
                 ::||   :|......|..:|..||||.:....: .|.|:.:.:.:.....|...|     
Mouse   138 -----TVQTTLCLPQPTYHFPFGASCWATGWDQNTSDV-SRTLRNLRLRLISRPTCNCLYNRLHQ 196

  Fly   179 ---GNGVFNEDICAGRM--GKGGCYGDSGGPLVF---NGQ--LVGITSRTGNIVCLGSS---LYA 230
               .|......:|.|..  .:|.|.||||||::.   :|.  .|||.|.|..  |....   |..
Mouse   197 RLLSNPARPGMLCGGAQPGEQGPCQGDSGGPVMCREPDGHWVQVGIISFTSK--CAQEDTPVLLT 259

  Fly   231 SVARYRNWILSAIDVLHF--QAP 251
            .:|.:.:|:.:.:....|  |||
Mouse   260 DMAVHSSWLQAHVHEAAFLVQAP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 64/250 (26%)
Tryp_SPc 30..239 CDD:238113 63/249 (25%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 2/19 (11%)
Tryp_SPc 45..271 CDD:238113 62/234 (26%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839492
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.