DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and LOC3290018

DIOPT Version :10

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_556312.3 Gene:LOC3290018 / 3290018 VectorBaseID:AGAMI1_011462 Length:299 Species:Anopheles gambiae


Alignment Length:167 Identity:35/167 - (20%)
Similarity:57/167 - (34%) Gaps:66/167 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTNTMRYYDP-------KQFTASGIEHVKLNVPGQVVPPVRIVDRFIEIVKSYLNDP-ESEGKLI 61
            |||.:|...|       |...|:|:|.          |.|:      |::|...:|. :::.:|:
Mosquito   121 LTNLVRVARPLLPAATLKNILANGVED----------PQVQ------ELIKLLRSDNFKTQVQLL 169

  Fly    62 GVHCTHGLNRTGYLICAYMILQLGYDPN---EAIRLF--------------NAKRGHRMERDKYL 109
            .....|      .|:..|:..:|..||.   |.:|:|              |.:.|.|    ..|
Mosquito   170 KATKQH------QLLHDYVCRRLKLDPTYYAEYVRVFLDLHISDPPTIKLPNRRPGVR----GLL 224

  Fly   110 ESLRQMAPAGQDNGRLGVQPEGGYTIRSGMHPEAYDS 146
            :.||:..|.               |....|:.:.|.|
Mosquito   225 QDLREALPR---------------TALRNMYQQLYSS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 26/136 (19%)
LOC3290018XP_556312.3 None

Return to query results.
Submit another query.