DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG33160

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:260 Identity:80/260 - (30%)
Similarity:120/260 - (46%) Gaps:21/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSKCFHLLLAVHLL--ISPVV--PVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYS 61
            |.::|...|..|.:|  .|.|.  |..::...|||||....|.:..:.|.:. ..|..||||:..
  Fly     1 MIARCLTSLFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVT-TSEELCGGSLVK 64

  Fly    62 KTIIITAAHCI---KEGERSIRAGSSLHDSGGVVVGVEAYI-IHPQFDKHNMENDVAVLKLSSPL 122
            ...:||||||:   .:.:..|..|:|.......|:....|| |.|.|::..:..|||.|:|:|.:
  Fly    65 PRWVITAAHCVYNKNKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM 129

  Fly   123 SFSDSIQTIPLAETDPPTSSSALATGWGRGNFLI--RPRQLQGVEILIRPL-----IVCKLKYGN 180
             ...:|:|||||....|..:....:|||   ||.  ..:..:.|..::.|:     .|...:..:
  Fly   130 -IGANIETIPLAAQSVPARALVKVSGWG---FLTADATKTAERVHSVLVPMWSRASCVSAFRGIH 190

  Fly   181 GVFNEDICAGRM-GKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGSSLYASVARYRNWILSAID 244
            .:....:||.|: .|..|.||||||||:.|||.||.|...........:|.||...|:|....::
  Fly   191 RITRSMVCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGCASALPGIYTSVPEIRDWFQRVVE 255

  Fly   245  244
              Fly   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 71/221 (32%)
Tryp_SPc 30..239 CDD:238113 70/220 (32%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 71/220 (32%)
Tryp_SPc 34..253 CDD:238113 71/223 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.